PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00054614001
Common NameGSBRNA2T00054614001, LOC106396534, LOC106396535
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 328aa    MW: 35495.6 Da    PI: 9.7229
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00054614001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.53e-3847107262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++ +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  GSBRNA2T00054614001  47 PQPQLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVK 107
                          67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.6E-3350105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90151105IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-2751105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MFGNCDQKKK MPSISSPNTI PLASMQSKNM IVAPSHKQQQ QQQAHQPQPQ LKCPRCDSSN  60
TKFCYYNNYS LSQPRHFCKA CKRYWTRGGT LRNVPVGGSY RKNKRVKRPA TAASTVSKTT  120
SSSPNHQISH FSSMNHHPML YGLSDHVNSC NSLPMIPSRF NDSSKTSSSG LESEFFSSGF  180
SGLGALGLGF PHHMSHDHTA INGGFIDNST ANKPFLLSGL FGSSVSSSSS NLVQHPHKPM  240
NNGGEMMGQS HLQTLASLQD LHVGGNNEDV NKEGKLGQIS GTISGFMSPS SLDPSNYNNI  300
WNNASVVNGE WLDSTNNNVG SSLTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2992720.0AY299272.1 Arabidopsis thaliana clone D2 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593055.10.0PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_013692400.10.0PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_013692401.10.0PREDICTED: dof zinc finger protein DOF1.4-like
SwissprotQ9FZA41e-146DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLA0A078JJD90.0A0A078JJD9_BRANA; BnaCnng51540D protein
TrEMBLA0A0D3D6960.0A0A0D3D696_BRAOL; Uncharacterized protein
STRINGBra030089.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-132Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]